McDonnell Genome Institute

Washington University

Transcript

PCAT1:38

Chromosome

chr8

Gene Name

PCAT1

Start

126973234

CPC Label

noncoding

End

127064895

Cancer

OV

Strand

+

Peptide

MYSFVVLEVK

Modified Peptide

n[145]M[147]YSFVVLEVK

Peptide Length

10

ORF Length

33

Open Reading Frame (ORF)

MYSFVVLEVKKFEIKVSARSSHLLGCTRFSSTA

Conservation Score

0.966

PhyloCSF Frame 1

-3.62

No. of Spectra

26

CPC Coding Probability

0.0480529

PhyloCSF Frame 2 

-5.096

CNTI Index

noncoding

Max Probability

0.9017

PhyloCSF Frame 3

-3.475

CNTI Score

-0.373066624