McDonnell Genome Institute

Washington University

Transcript

PAUPAR:10

Chromosome

chr11

Gene Name

PAUPAR

Start

31819146

CPC Label

noncoding

End

31837055

Cancer

BRCA-Luminal B

Strand

+

Peptide

MGALAEK

Modified Peptide

n[145]MGALAEK

Peptide Length

7

ORF Length

68

Open Reading Frame (ORF)

LSCSARRGLEGRVGVGVGVGVEVGVAVKVGRRMGALAEKFPQDVLTYLQTFSKLSFFFLTPWASCVKA

Conservation Score

0.226

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.211025

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

0

CNTI Score

-0.27025735