McDonnell Genome Institute

Washington University

Transcript

PARTICL:2

Chromosome

chr2

Gene Name

PARTICL

Start

85536387

CPC Label

noncoding

End

85538977

Cancer

PRAD

Strand

-

Peptide

TILSVGAGGK

Modified Peptide

Peptide Length

10

ORF Length

75

Open Reading Frame (ORF)

LLAAVEQGAFPRTILSVGAGGKVGFAKGSVGNKGSTWAVLGASTKKIKGSSPDSVTTSTVAQSRQQEKVRPQKRQ

Conservation Score

1

PhyloCSF Frame 1

-2.098

No. of Spectra

1

CPC Coding Probability

0.160175

PhyloCSF Frame 2 

-4.323

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

-4.539

CNTI Score

-0.3348936