McDonnell Genome Institute

Washington University

Transcript

PART1:6

Chromosome

chr5

Gene Name

PART1

Start

60488139

CPC Label

noncoding

End

60547657

Cancer

LUAD

Strand

+

Peptide

ASQSITK

Modified Peptide

n[230]ASQSITK

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

MASQSITKLRILTVLCISSLHVMYMCVFVYINHFPFSLFIIL

Conservation Score

0.814

PhyloCSF Frame 1

-5.407

No. of Spectra

24

CPC Coding Probability

0.0513729

PhyloCSF Frame 2 

-5.113

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-4.965

CNTI Score

-0.345744014