McDonnell Genome Institute

Washington University

Transcript

PART1:16

Chromosome

chr5

Gene Name

PART1

Start

60488177

CPC Label

noncoding

End

60492853

Cancer

OV

Strand

+

Peptide

DEIMSFAGR

Modified Peptide

n[145]DEIMSFAGR

Peptide Length

9

ORF Length

54

Open Reading Frame (ORF)

LKMKVNSMEYYAAIKKDEIMSFAGRWMKLETIILSKLSQGQKTKHRMFSLIGGN

Conservation Score

0.041

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0959524

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6609

PhyloCSF Frame 3

0

CNTI Score

-0.335908263