McDonnell Genome Institute

Washington University

Transcript

PARD6G-AS1:1

Chromosome

chr18

Gene Name

PARD6G-AS1

Start

80147668

CPC Label

noncoding

End

80149203

Cancer

EOGC

Strand

+

Peptide

SQPLLAQGCR

Modified Peptide

n[145]SQPLLAQGCR

Peptide Length

10

ORF Length

99

Open Reading Frame (ORF)

LEHAAFSHACVHKYIISDSLQVYISKPIQAMAARTSPSPSSRPLGPQDRGQKSQPLLAQGCRDPVMAAVPLLRCQVRAETSAPAAPAPFVSRRSVSLVL

Conservation Score

0.038

PhyloCSF Frame 1

0

No. of Spectra

40

CPC Coding Probability

0.0440345

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.312805458