McDonnell Genome Institute

Washington University

Transcript

PANTR1:34

Chromosome

chr2

Gene Name

PANTR1

Start

104797119

CPC Label

noncoding

End

104853569

Cancer

OV

Strand

-

Peptide

LIGGGGK

Modified Peptide

n[145]LIGGGGK

Peptide Length

7

ORF Length

128

Open Reading Frame (ORF)

LIGGGGKRGLASPRALVVATLLGNPPPQLSAAVARRRQPPLFKFSDAIIWETCSPGPARCPRVRDGPLAAAAPWLLHPLSPSFALPPFLPPPSSGIRASSVRALVSLEGAGQRSRAMYLKSNQSDLPP

Conservation Score

1

PhyloCSF Frame 1

5.393

No. of Spectra

1

CPC Coding Probability

0.0300041

PhyloCSF Frame 2 

1.457

CNTI Index

noncoding

Max Probability

0.2356

PhyloCSF Frame 3

0.614

CNTI Score

-0.341917019