McDonnell Genome Institute

Washington University

Transcript

PANDAR:1

Chromosome

chr6

Gene Name

PANDAR

Start

36673620

CPC Label

noncoding

End

36675126

Cancer

OV

Strand

-

Peptide

SLFQSQDELVK

Modified Peptide

n[145]SLFQSQDELVK

Peptide Length

11

ORF Length

76

Open Reading Frame (ORF)

MLLTSASWQSTTCLVQCLKRGILQTRSPVSMLASKSLFQSQDELVKTPVAPDPKATSMTPVKVVALRMTFGLNVCT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0583671

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3707

PhyloCSF Frame 3

0

CNTI Score

-0.346088177