McDonnell Genome Institute

Washington University

Transcript

PACRG-AS1:3

Chromosome

chr6

Gene Name

PACRG-AS1

Start

163309984

CPC Label

noncoding

End

163324462

Cancer

OSCC

Strand

-

Peptide

MSVSCLIYGGR

Modified Peptide

n[145]MSVSCLIYGGR

Peptide Length

11

ORF Length

37

Open Reading Frame (ORF)

MSVSCLIYGGRKVHRTRTHVSIPVSGLLSSDSILRAA

Conservation Score

0.12

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.246551

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9292

PhyloCSF Frame 3

0

CNTI Score

-0.309305139