McDonnell Genome Institute

Washington University

Transcript

P3H2-AS1:7

Chromosome

chr3

Gene Name

P3H2-AS1

Start

190120951

CPC Label

coding

End

190150133

Cancer

LUAD

Strand

+

Peptide

ITNYAQLTPHISHNFQNLFSSSYLK

Modified Peptide

ITNYAQLTPHISHNFQNLFSSSYLK

Peptide Length

25

ORF Length

77

Open Reading Frame (ORF)

LRAVAVAALILLEALKITNYAQLTPHISHNFQNLFSSSYLKHILSAPRLLQLYSLFAKSHNYHCSWPRLQSGLPHYS

Conservation Score

0

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.934144

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4637

PhyloCSF Frame 3

0

CNTI Score

-0.323277616