McDonnell Genome Institute

Washington University

Transcript

OVCH1-AS1:7

Chromosome

chr12

Gene Name

OVCH1-AS1

Start

29389288

CPC Label

noncoding

End

29394817

Cancer

CCRC

Strand

+

Peptide

GGGGAESSMTSCLQR

Modified Peptide

n[230]GGGGAESSM[147]TSCLQR

Peptide Length

15

ORF Length

44

Open Reading Frame (ORF)

MLIVQCGSGEERGGGGAESSMTSCLQRGKMNHYLCAFCFTYLCI

Conservation Score

0.051

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.13143

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9943

PhyloCSF Frame 3

0

CNTI Score

-0.27616697