McDonnell Genome Institute

Washington University

Transcript

OTUD6B-AS1:8

Chromosome

chr8

Gene Name

OTUD6B-AS1

Start

91059908

CPC Label

noncoding

End

91070123

Cancer

CCRC

Strand

-

Peptide

SLSQVESAK

Modified Peptide

n[230]SLSQVESAK

Peptide Length

9

ORF Length

59

Open Reading Frame (ORF)

MCHLHATFATKRFNVMHDLKVPHPDTLWKVKSVTNKSRSLSQVESAKDDTCLSVHEYPP

Conservation Score

0.813

PhyloCSF Frame 1

-5.1

No. of Spectra

22

CPC Coding Probability

0.0586158

PhyloCSF Frame 2 

-5.294

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

-4.467

CNTI Score

-0.356448713