McDonnell Genome Institute

Washington University

Transcript

OSGEPL1-AS1:4

Chromosome

chr2

Gene Name

OSGEPL1-AS1

Start

189762838

CPC Label

noncoding

End

189765327

Cancer

OV

Strand

+

Peptide

SLCAPAFPPDLQMESHSVAR

Modified Peptide

n[145]SLCAPAFPPDLQMESHSVAR

Peptide Length

20

ORF Length

98

Open Reading Frame (ORF)

MLSEEKLKGRLCPKRSLCAPAFPPDLQMESHSVARLECSGAISAHYNLHLRGSSDSPASAFRVAGTTGACHHSQLIFVFLVEMTFHYVGQAGFELLTS

Conservation Score

0.09

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.243274

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6731

PhyloCSF Frame 3

0

CNTI Score

-0.401344091