McDonnell Genome Institute

Washington University

Transcript

OR2A1-AS1:21

Chromosome

chr7

Gene Name

OR2A1-AS1

Start

144250853

CPC Label

noncoding

End

144256249

Cancer

BRCA-Luminal A

Strand

-

Peptide

VLAHNYK

Modified Peptide

n[145]VLAHNYK

Peptide Length

7

ORF Length

50

Open Reading Frame (ORF)

MKLTLSSSWSTIVLISRKRTYVINSDSIRQLCKVLAHNYKSRLNQTGLLF

Conservation Score

0.019

PhyloCSF Frame 1

-5.216

No. of Spectra

10

CPC Coding Probability

0.128016

PhyloCSF Frame 2 

-4.07

CNTI Index

coding

Max Probability

0.9999

PhyloCSF Frame 3

-4.124

CNTI Score

0.718383635