McDonnell Genome Institute

Washington University

Transcript

OR2A1-AS1:19

Chromosome

chr7

Gene Name

OR2A1-AS1

Start

144250044

CPC Label

coding

End

144252957

Cancer

OV

Strand

-

Peptide

LVTCLLFPTVFLQTGTPYNR

Modified Peptide

n[145]LVTCLLFPTVFLQTGTPYNR

Peptide Length

20

ORF Length

106

Open Reading Frame (ORF)

LVTCLLFPTVFLQTGTPYNRLHLGSLNESHSSAVPPRDFIKAPAVAFWRLLKLSTQCFLKVSCFSPLDCYSHQLHVGFTNLFLRMQVCLLYPRETHLYIPVSTDKN

Conservation Score

0.68

PhyloCSF Frame 1

-4.156

No. of Spectra

2

CPC Coding Probability

0.979563

PhyloCSF Frame 2 

-3.82

CNTI Index

coding

Max Probability

0.9832

PhyloCSF Frame 3

-4.379

CNTI Score

0.742030299