McDonnell Genome Institute

Washington University

Transcript

OLMALINC:4

Chromosome

chr10

Gene Name

OLMALINC

Start

100373449

CPC Label

coding

End

100388314

Cancer

EOGC

Strand

+

Peptide

ILPLYLPTLIHK

Modified Peptide

n[145]ILPLYLPTLIHK

Peptide Length

12

ORF Length

52

Open Reading Frame (ORF)

LFLDYSHTSLPPFSPVQSLLRILPLYLPTLIHKYGTPLFPPWQPIMHPLPSH

Conservation Score

0.289

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.823747

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

0

CNTI Score

-0.349470362