McDonnell Genome Institute

Washington University

Transcript

OIP5-AS1:36

Chromosome

chr15

Gene Name

OIP5-AS1

Start

41284007

CPC Label

noncoding

End

41508868

Cancer

OV

Strand

+

Peptide

EQLIIIHSSLK

Modified Peptide

n[145]EQLIIIHSSLK

Peptide Length

11

ORF Length

58

Open Reading Frame (ORF)

MSQDRATALQPGLQSEIPSQKKISILFFHSGCSDLHSREQLIIIHSSLKRGKFWNIFI

Conservation Score

0.057

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0400645

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.353695372