McDonnell Genome Institute

Washington University

Transcript

OIP5-AS1:18

Chromosome

chr15

Gene Name

OIP5-AS1

Start

41284030

CPC Label

noncoding

End

41289155

Cancer

OV

Strand

+

Peptide

IIETESRMMVAR

Modified Peptide

n[145]IIETESRMMVAR

Peptide Length

12

ORF Length

52

Open Reading Frame (ORF)

LHPSLGSIRIIETESRMMVARGCRKGSERELLCNVYKVSVWEEEMSPGDGLR

Conservation Score

0.924

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0144556

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9623

PhyloCSF Frame 3

0

CNTI Score

-0.384989416