McDonnell Genome Institute

Washington University

Transcript

NUTM2B-AS1:40

Chromosome

chr10

Gene Name

NUTM2B-AS1

Start

79680375

CPC Label

noncoding

End

79683563

Cancer

HCC

Strand

-

Peptide

SLLSDINIAK

Modified Peptide

n[230]SLLSDINIAK

Peptide Length

10

ORF Length

66

Open Reading Frame (ORF)

LCVSEYTYTSLTTSSIVDSFIWMMDTSSFQVIISALKSLLSDINIAKQIFIWLVFDYLLYAYMKGF

Conservation Score

0.75

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.03449

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

0.691331852