McDonnell Genome Institute

Washington University

Transcript

NUTM2A-AS1:45

Chromosome

chr10

Gene Name

NUTM2A-AS1

Start

87213717

CPC Label

noncoding

End

87342343

Cancer

OV

Strand

-

Peptide

GSAPAPGPCLHSLQEAGSLAVMFGGLR

Modified Peptide

n[145]GSAPAPGPCLHSLQEAGSLAVM[147]FGGLR

Peptide Length

27

ORF Length

214

Open Reading Frame (ORF)

LPGQASLGPPPPCPPGLFSPGRAAGPGRDPAVLGRGSGGSVGEGSRAAGGASGHVPAEGRGSGGTAGEGRAAPCPGPRGSAPAPGPCLHSLQEAGSLAVMFGGLRRRLVAPTHRPAAPPPPPPPGVWIPPPRLGPSCSTRRSIVSPNPQRPGPSFLIPSFLTFHPVPRPAFPLPALSCRFLNTLHTRTSSSSSSLFPTPTFGPSFLNLRWPPIP

Conservation Score

0.988

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.349699

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6978

PhyloCSF Frame 3

0

CNTI Score

-0.265434552