McDonnell Genome Institute

Washington University

Transcript

NUTM2A-AS1:34

Chromosome

chr10

Gene Name

NUTM2A-AS1

Start

87320199

CPC Label

noncoding

End

87342590

Cancer

OV

Strand

-

Peptide

SEVFLTHLDR

Modified Peptide

n[145]SEVFLTHLDR

Peptide Length

10

ORF Length

47

Open Reading Frame (ORF)

MRKAILRSHVTHLDRSEVFLTHLDRSEVTSPCGKTTFNFVRNCKAIF

Conservation Score

0.028

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0969719

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9974

PhyloCSF Frame 3

0

CNTI Score

0.688512928