McDonnell Genome Institute

Washington University

Transcript

NUTM2A-AS1:27

Chromosome

chr10

Gene Name

NUTM2A-AS1

Start

87206718

CPC Label

noncoding

End

87214544

Cancer

OSCC

Strand

-

Peptide

ENTLLWGK

Modified Peptide

n[145]ENTLLWGK

Peptide Length

8

ORF Length

44

Open Reading Frame (ORF)

LLFQPGFLCLLPGRENTLLWGKSQGGRCDQHTQAPSVGMAHCAG

Conservation Score

0.177

PhyloCSF Frame 1

-5.506

No. of Spectra

8

CPC Coding Probability

0.181929

PhyloCSF Frame 2 

-4.425

CNTI Index

coding

Max Probability

0.9846

PhyloCSF Frame 3

-3.984

CNTI Score

0.691276966