McDonnell Genome Institute

Washington University

Transcript

NUTM2A-AS1:26

Chromosome

chr10

Gene Name

NUTM2A-AS1

Start

87207906

CPC Label

noncoding

End

87216799

Cancer

OV

Strand

-

Peptide

QFCFYLSCLGIIK

Modified Peptide

n[145]QFCFYLSCLGIIK

Peptide Length

13

ORF Length

87

Open Reading Frame (ORF)

MQFCFYLSCLGIIKLYQFWKVLSLYLFNCSFCPIFLPSSKTPVTYVLGLFTTSHKYLMFFAVFSILFVSVFQLRVFILSCITVQRMF

Conservation Score

0.212

PhyloCSF Frame 1

-4.428

No. of Spectra

1

CPC Coding Probability

0.199238

PhyloCSF Frame 2 

-5.013

CNTI Index

noncoding

Max Probability

0.8378

PhyloCSF Frame 3

-4.152

CNTI Score

-0.297350758