McDonnell Genome Institute

Washington University

Transcript

NUTM2A-AS1:10

Chromosome

chr10

Gene Name

NUTM2A-AS1

Start

87203852

CPC Label

noncoding

End

87342542

Cancer

OV

Strand

-

Peptide

SSSGPPAGQLLSGASTQAHGSMK

Modified Peptide

n[145]SSSGPPAGQLLSGASTQAHGSMK

Peptide Length

23

ORF Length

111

Open Reading Frame (ORF)

LPPVAAGIPEDSGPGSTQSSSRPGNTSSSSRPPPPPPRRFLLRLPASFAPPRPRSSSGPPAGQLLSGASTQAHGSMKQEEEAERERSRPPQPRLGQEKSKTIFLLLSVLMH

Conservation Score

0.982

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0120368

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

0

CNTI Score

-0.284937553