McDonnell Genome Institute

Washington University

Transcript

NUP50-DT:54

Chromosome

chr22

Gene Name

NUP50-DT

Start

45139040

CPC Label

noncoding

End

45147867

Cancer

OSCC

Strand

-

Peptide

AGPWPHSPK

Modified Peptide

n[145]AGPWPHSPK

Peptide Length

9

ORF Length

96

Open Reading Frame (ORF)

MLSYCFKCLISLAFCRYPGGIICVGSLRPGKDLPVSSSARFLGAPSDDNSSQVKVSGVLGPKMLQVPWMPVHLRAGPWPHSPKGCLFSFLNFSFIP

Conservation Score

0.44

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.394531

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8935

PhyloCSF Frame 3

0

CNTI Score

-0.351657135