McDonnell Genome Institute

Washington University

Transcript

NUCB1-AS1:1

Chromosome

chr19

Gene Name

NUCB1-AS1

Start

48910929

CPC Label

noncoding

End

48918891

Cancer

HCC

Strand

-

Peptide

LSSHPGGFK

Modified Peptide

n[230]LSSHPGGFK

Peptide Length

9

ORF Length

63

Open Reading Frame (ORF)

LSSHPGGFKGTAGGNKWLIWASLQVPEASKMLTSLVKSASSSCSSRTPSLLISEGKRIARRFR

Conservation Score

1

PhyloCSF Frame 1

-4.194

No. of Spectra

12

CPC Coding Probability

0.0152094

PhyloCSF Frame 2 

11.122

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

6.155

CNTI Score

-0.382092432