McDonnell Genome Institute

Washington University

Transcript

NRSN2-AS1:11

Chromosome

chr20

Gene Name

NRSN2-AS1

Start

336383

CPC Label

noncoding

End

348209

Cancer

EOGC

Strand

-

Peptide

STMIAPLHSSLGNNNK

Modified Peptide

n[145]STM[147]IAPLHSSLGNNNK

Peptide Length

16

ORF Length

50

Open Reading Frame (ORF)

LRWEVHLSPRRLRLRSTMIAPLHSSLGNNNKKACDCLGLKMILVTSYPLG

Conservation Score

0.249

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.231748

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9978

PhyloCSF Frame 3

0

CNTI Score

0.677119873