McDonnell Genome Institute

Washington University

Transcript

NRIR:3

Chromosome

chr2

Gene Name

NRIR

Start

6820068

CPC Label

noncoding

End

6840365

Cancer

OV

Strand

-

Peptide

GDSHLSQWAGR

Modified Peptide

n[145]GDSHLSQWAGR

Peptide Length

11

ORF Length

86

Open Reading Frame (ORF)

LTVSLMKLKDAKYCSWCDCEGVAKGDSHLSQWAGRGRPTLNLGGHHLISCQHGWNKSRQKNMERLDWLSLLASIFLPWLPCSSACR

Conservation Score

0.125

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.263771

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2026

PhyloCSF Frame 3

0

CNTI Score

-0.364387896