McDonnell Genome Institute

Washington University

Transcript

NR2F2-AS1:56

Chromosome

chr15

Gene Name

NR2F2-AS1

Start

96080712

CPC Label

noncoding

End

96084584

Cancer

OV

Strand

-

Peptide

IIGEIGK

Modified Peptide

n[145]IIGEIGK

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

LGSICHSTTDYGLVRMDFQQQEPKIIGEIGKLLYRY

Conservation Score

1

PhyloCSF Frame 1

-4.863

No. of Spectra

4

CPC Coding Probability

0.058793

PhyloCSF Frame 2 

-4.04

CNTI Index

noncoding

Max Probability

0.9669

PhyloCSF Frame 3

-4.556

CNTI Score

-0.370135689