McDonnell Genome Institute

Washington University

Transcript

NR2F2-AS1:52

Chromosome

chr15

Gene Name

NR2F2-AS1

Start

96088325

CPC Label

noncoding

End

96135841

Cancer

EOGC

Strand

-

Peptide

QIWGFTWSLLHHVTFQIWPCTNHTGK

Modified Peptide

n[145]QIWGFTWSLLHHVTFQIWPCTNHTGK

Peptide Length

26

ORF Length

57

Open Reading Frame (ORF)

MERQIWGFTWSLLHHVTFQIWPCTNHTGKVCFRTFSLVLLIKYIFPTGISSAIKVDN

Conservation Score

1

PhyloCSF Frame 1

-4.686

No. of Spectra

6

CPC Coding Probability

0.141071

PhyloCSF Frame 2 

-3.977

CNTI Index

coding

Max Probability

0.8329

PhyloCSF Frame 3

-3.819

CNTI Score

0.643533762