McDonnell Genome Institute

Washington University

Transcript

NR2F2-AS1:41

Chromosome

chr15

Gene Name

NR2F2-AS1

Start

96288029

CPC Label

coding

End

96327178

Cancer

OSCC

Strand

-

Peptide

AIVHLASSAMLYPR

Modified Peptide

n[145]AIVHLASSAMLYPR

Peptide Length

14

ORF Length

66

Open Reading Frame (ORF)

MSYSGLFKEKTETPCLEVIGPSTLETSPWQWSLPMLQKTAKIRAIVHLASSAMLYPRGKFLPHSSW

Conservation Score

1

PhyloCSF Frame 1

-4.582

No. of Spectra

18

CPC Coding Probability

0.519548

PhyloCSF Frame 2 

-3.935

CNTI Index

noncoding

Max Probability

0.8487

PhyloCSF Frame 3

-4.433

CNTI Score

-0.377268221