McDonnell Genome Institute

Washington University

Transcript

NR2F2-AS1:40

Chromosome

chr15

Gene Name

NR2F2-AS1

Start

96210522

CPC Label

noncoding

End

96327178

Cancer

BRCA-Luminal A

Strand

-

Peptide

AGQEGFK

Modified Peptide

n[145]AGQEGFK

Peptide Length

7

ORF Length

53

Open Reading Frame (ORF)

LSPYWLFLKVKGWGYVLQRAGQEGFKHITGCKISFLEVMARTVRSLMPNVNSC

Conservation Score

1

PhyloCSF Frame 1

-5.713

No. of Spectra

77

CPC Coding Probability

0.292406

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9961

PhyloCSF Frame 3

0.239

CNTI Score

-0.33329492