McDonnell Genome Institute

Washington University

Transcript

NR2F2-AS1:39

Chromosome

chr15

Gene Name

NR2F2-AS1

Start

96210522

CPC Label

coding

End

96327178

Cancer

PRAD

Strand

-

Peptide

LWLYLLYLSTDLIMGNK

Modified Peptide

LWLYLLYLSTDLIM[147]GNK

Peptide Length

17

ORF Length

38

Open Reading Frame (ORF)

LVLDIFYQDWKFNCLIKLWLYLLYLSTDLIMGNKMLLC

Conservation Score

0.995

PhyloCSF Frame 1

-3.942

No. of Spectra

1

CPC Coding Probability

0.694377

PhyloCSF Frame 2 

-4.564

CNTI Index

coding

Max Probability

0.9956

PhyloCSF Frame 3

-5.16

CNTI Score

0.621567912