McDonnell Genome Institute

Washington University

Transcript

NR2F2-AS1:29

Chromosome

chr15

Gene Name

NR2F2-AS1

Start

96080616

CPC Label

coding

End

96330349

Cancer

CCRC

Strand

-

Peptide

LHGLFPR

Modified Peptide

n[230]LHGLFPR

Peptide Length

7

ORF Length

45

Open Reading Frame (ORF)

LHGLFPRLVQISSQLSFLLQLSLIPSSFFPLFVFIYFCSLFSSLL

Conservation Score

0.105

PhyloCSF Frame 1

-5.954

No. of Spectra

3

CPC Coding Probability

0.806109

PhyloCSF Frame 2 

-6.379

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

-6.29

CNTI Score

-0.331134843