McDonnell Genome Institute

Washington University

Transcript

NR2F2-AS1:18

Chromosome

chr15

Gene Name

NR2F2-AS1

Start

96269279

CPC Label

noncoding

End

96274735

Cancer

CCRC

Strand

-

Peptide

ETQIGSILK

Modified Peptide

n[230]ETQIGSILK

Peptide Length

9

ORF Length

73

Open Reading Frame (ORF)

METQIGSILKKRRMDLFRQHKPRKGLRGETNWVMDERGQLECRIEAVINILALIMHQLQVDSLALCQLVHVGS

Conservation Score

0.907

PhyloCSF Frame 1

-2.553

No. of Spectra

1

CPC Coding Probability

0.0421851

PhyloCSF Frame 2 

-4.833

CNTI Index

noncoding

Max Probability

0.444

PhyloCSF Frame 3

-5.002

CNTI Score

-0.424389441