McDonnell Genome Institute

Washington University

Transcript

NR2F2-AS1:11

Chromosome

chr15

Gene Name

NR2F2-AS1

Start

96127368

CPC Label

noncoding

End

96327021

Cancer

OV

Strand

-

Peptide

ASAAPSMTTIFGCLK

Modified Peptide

n[145]ASAAPSM[147]TTIFGCLK

Peptide Length

15

ORF Length

41

Open Reading Frame (ORF)

MSVRPLSWTFSPAAGDGLVFPSCYRASAAPSMTTIFGCLKA

Conservation Score

0.851

PhyloCSF Frame 1

-5.333

No. of Spectra

2

CPC Coding Probability

0.0455527

PhyloCSF Frame 2 

-5.25

CNTI Index

noncoding

Max Probability

0.7019

PhyloCSF Frame 3

-4.415

CNTI Score

-0.352060342