McDonnell Genome Institute

Washington University

Transcript

NR2F1-AS1:13

Chromosome

chr5

Gene Name

NR2F1-AS1

Start

93541871

CPC Label

noncoding

End

93581297

Cancer

OV

Strand

-

Peptide

SLGWVGNEDGR

Modified Peptide

n[145]SLGWVGNEDGR

Peptide Length

11

ORF Length

80

Open Reading Frame (ORF)

MRARLWPKIFRQMFPSFAISLFFPPLLLLVSRQPSWKSLGWVGNEDGRFHSRYSPLRSNLMQREFSGLCATLHGILSLDF

Conservation Score

0.714

PhyloCSF Frame 1

-4.817

No. of Spectra

2

CPC Coding Probability

0.0881305

PhyloCSF Frame 2 

-4.926

CNTI Index

noncoding

Max Probability

0.6159

PhyloCSF Frame 3

-4.165

CNTI Score

-0.369025244