McDonnell Genome Institute

Washington University

Transcript

NPSR1-AS1:9

Chromosome

chr7

Gene Name

NPSR1-AS1

Start

34346511

CPC Label

noncoding

End

34761191

Cancer

OSCC

Strand

-

Peptide

LTQMANTHLK

Modified Peptide

n[145]LTQMANTHLK

Peptide Length

10

ORF Length

34

Open Reading Frame (ORF)

MLFEDLLYLYKPLSIKLTQMANTHLKRCGISLFH

Conservation Score

0.069

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0355019

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9759

PhyloCSF Frame 3

0

CNTI Score

-0.328568946