McDonnell Genome Institute

Washington University

Transcript

NPSR1-AS1:4

Chromosome

chr7

Gene Name

NPSR1-AS1

Start

34718861

CPC Label

noncoding

End

34834331

Cancer

OV

Strand

-

Peptide

LSEELSLMFLK

Modified Peptide

n[145]LSEELSLM[147]FLK

Peptide Length

11

ORF Length

47

Open Reading Frame (ORF)

LSEELSLMFLKVQVCCLCEKKRRETVQSLQSSCPSVSCEKKTRAPIC

Conservation Score

0.323

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0151539

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5351

PhyloCSF Frame 3

0

CNTI Score

-0.366967096