McDonnell Genome Institute

Washington University

Transcript

NOP14-AS1:3

Chromosome

chr4

Gene Name

NOP14-AS1

Start

2934939

CPC Label

noncoding

End

2940504

Cancer

PRAD

Strand

+

Peptide

SFGPGWSTLTEPR

Modified Peptide

Peptide Length

13

ORF Length

102

Open Reading Frame (ORF)

LAPFWPPAPLPAAPLPGSPEGGAGALSGRRSTRPTLEETVPLGRRSFGPGWSTLTEPRQRLACSQLPPPLPPSKMLADLTWPTLTRYTWGKESGGTHTAFTP

Conservation Score

0.065

PhyloCSF Frame 1

0

No. of Spectra

40

CPC Coding Probability

0.0408079

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

0

CNTI Score

-0.288597763