McDonnell Genome Institute

Washington University

Transcript

NNT-AS1:16

Chromosome

chr5

Gene Name

NNT-AS1

Start

43596920

CPC Label

noncoding

End

43603104

Cancer

OSCC

Strand

-

Peptide

MGFLDFSVSNNADTR

Modified Peptide

n[145]MGFLDFSVSNNADTR

Peptide Length

15

ORF Length

43

Open Reading Frame (ORF)

MGFLDFSVSNNADTRQVLREPSLTLILALFSQADQSRVFDFRK

Conservation Score

0.998

PhyloCSF Frame 1

-5.826

No. of Spectra

12

CPC Coding Probability

0.346649

PhyloCSF Frame 2 

-5.12

CNTI Index

noncoding

Max Probability

0.9847

PhyloCSF Frame 3

-5.546

CNTI Score

-0.341888798