McDonnell Genome Institute

Washington University

Transcript

NIPBL-DT:16

Chromosome

chr5

Gene Name

NIPBL-DT

Start

36863663

CPC Label

noncoding

End

36876656

Cancer

EOGC

Strand

-

Peptide

TIFFLLAR

Modified Peptide

n[145]TIFFLLAR

Peptide Length

8

ORF Length

49

Open Reading Frame (ORF)

LGNIVRPPSLKTIFFLLARCGGVDLSSQLLERLKGEDRLSPGGRGCSES

Conservation Score

0.3

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0523063

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

0.671154846