McDonnell Genome Institute

Washington University

Transcript

NIFK-AS1:8

Chromosome

chr2

Gene Name

NIFK-AS1

Start

121649797

CPC Label

noncoding

End

121651128

Cancer

OV

Strand

+

Peptide

SLCAELLASVCVGMGEK

Modified Peptide

n[145]SLCAELLASVCVGMGEK

Peptide Length

17

ORF Length

34

Open Reading Frame (ORF)

MHCPVRCFYWRSLCAELLASVCVGMGEKCGRTMR

Conservation Score

0.54

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0599056

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9588

PhyloCSF Frame 3

0

CNTI Score

-0.383900901