McDonnell Genome Institute

Washington University

Transcript

NIFK-AS1:19

Chromosome

chr2

Gene Name

NIFK-AS1

Start

121649647

CPC Label

noncoding

End

121655196

Cancer

OSCC

Strand

+

Peptide

HSNMMKELFWVCLVFFR

Modified Peptide

n[145]HSNM[147]MKELFWVCLVFFR

Peptide Length

17

ORF Length

114

Open Reading Frame (ORF)

LRQEKCLNPGSGGCGERKLRRRTQAGRQRDSVSKISINRMWEILKPSIEIHTLYCLRSVTRHSNMMKELFWVCLVFFRDRVSLCCPGWRAVVRSRLTATSASLVEAILFPQPPE

Conservation Score

0.65

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0618205

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4245

PhyloCSF Frame 3

0

CNTI Score

-0.369453093