McDonnell Genome Institute

Washington University

Transcript

NGF-AS1:6

Chromosome

chr1

Gene Name

NGF-AS1

Start

115280316

CPC Label

noncoding

End

115367013

Cancer

BRCA-Luminal A

Strand

+

Peptide

DSLQAAVVEGR

Modified Peptide

n[145]DSLQAAVVEGR

Peptide Length

11

ORF Length

49

Open Reading Frame (ORF)

LGWRDSLQAAVVEGRFAQLTLGAGPPEPSSHTQEDGSEEARTGKSDPPL

Conservation Score

0.994

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.120316

PhyloCSF Frame 2 

-5.168

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-4.634

CNTI Score

-0.335781295