McDonnell Genome Institute

Washington University

Transcript

NFIA-AS2:8

Chromosome

chr1

Gene Name

NFIA-AS2

Start

60940242

CPC Label

noncoding

End

60990003

Cancer

BRCA-Luminal B

Strand

-

Peptide

KEIQEAR

Modified Peptide

n[145]KEIQEAR

Peptide Length

7

ORF Length

37

Open Reading Frame (ORF)

LTCSCWPWRKEKQSHCDWRKEIQEARTALSVSSNGWV

Conservation Score

0.155

PhyloCSF Frame 1

1.253

No. of Spectra

5

CPC Coding Probability

0.101639

PhyloCSF Frame 2 

-5.691

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

-4.944

CNTI Score

-0.361814957