McDonnell Genome Institute

Washington University

Transcript

NFIA-AS2:16

Chromosome

chr1

Gene Name

NFIA-AS2

Start

60954093

CPC Label

noncoding

End

60970740

Cancer

EOGC

Strand

-

Peptide

ANVLHFRTLISLGLPAEK

Modified Peptide

n[145]ANVLHFRTLISLGLPAEK

Peptide Length

18

ORF Length

46

Open Reading Frame (ORF)

LYEHVTITPPTVKANVLHFRTLISLGLPAEKQSLTLFLTNAFRHAL

Conservation Score

1

PhyloCSF Frame 1

-1.422

No. of Spectra

2

CPC Coding Probability

0.0146593

PhyloCSF Frame 2 

-3.244

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-4.021

CNTI Score

-0.362168601