McDonnell Genome Institute

Washington University

Transcript

NFIA-AS1:12

Chromosome

chr1

Gene Name

NFIA-AS1

Start

61247716

CPC Label

noncoding

End

61253503

Cancer

GBM

Strand

-

Peptide

AGTQNQINSK

Modified Peptide

n[230]AGTQNQINSK

Peptide Length

10

ORF Length

73

Open Reading Frame (ORF)

LCSNFGTMISAMFSNRVRKQTALREKAGTQNQINSKLKFSHFDKELHVFFCLLQMYVIKVGCLPFKTFEWITK

Conservation Score

1

PhyloCSF Frame 1

-3.092

No. of Spectra

2

CPC Coding Probability

0.0557533

PhyloCSF Frame 2 

-3.657

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

-5.419

CNTI Score

-0.446915791