McDonnell Genome Institute

Washington University

Transcript

NEXN-AS1:3

Chromosome

chr1

Gene Name

NEXN-AS1

Start

77880769

CPC Label

coding

End

77889258

Cancer

OV

Strand

-

Peptide

DQPGHDGETPSTK

Modified Peptide

n[145]DQPGHDGETPSTK

Peptide Length

13

ORF Length

53

Open Reading Frame (ORF)

LRSGVRDQPGHDGETPSTKNTKISRAWWYVPVIPATQEAEAGESLEPRRRRLQ

Conservation Score

0.336

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.707721

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8241

PhyloCSF Frame 3

0

CNTI Score

-0.278443189