McDonnell Genome Institute

Washington University

Transcript

NEAT1:6

Chromosome

chr11

Gene Name

NEAT1

Start

65422797

CPC Label

noncoding

End

65445540

Cancer

BRCA-Luminal B

Strand

+

Peptide

LQSAETAPLHSSLGDRAR

Modified Peptide

n[145]LQSAETAPLHSSLGDRAR

Peptide Length

18

ORF Length

72

Open Reading Frame (ORF)

LRQENLEPRRRRLQSAETAPLHSSLGDRARFRLKKKKKKKTKKKRNELELLLLGLKGIIRQVLGRIAGEAET

Conservation Score

0.234

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.219918

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.186

PhyloCSF Frame 3

0

CNTI Score

-0.270580375